Lineage for d4d65c_ (4d65 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022367Family f.4.3.0: automated matches [267625] (1 protein)
    not a true family
  6. 3022368Protein automated matches [267676] (11 species)
    not a true protein
  7. 3022392Species Providencia stuartii [TaxId:588] [311523] (4 PDB entries)
  8. 3022395Domain d4d65c_: 4d65 C: [311534]
    automated match to d2j1na_
    complexed with ftt, lda, myr, so4

Details for d4d65c_

PDB Entry: 4d65 (more details), 2.2 Å

PDB Description: structure of porin omp-pst2 from p. stuartii; the asymmetric unit contains a dimer of trimers.
PDB Compounds: (C:) porin 2

SCOPe Domain Sequences for d4d65c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d65c_ f.4.3.0 (C:) automated matches {Providencia stuartii [TaxId: 588]}
aevynkdgnkldvygqidvrhyfadaksgedgddsrvrlgfkgdtqitdqligfgrfewe
tstnkaetsndnqnrlayaglkfadygsldygrnygviydtnawtdvlplwgadtmdqed
tfmmgrnrnlltyrnnngfgyidglsfalqyqgkngdqnkstgssaldnngdgygfstay
elgwglsigggysnssrtpsqnniktgatgkraeawnvgskleldelylaamygqtlntt
rfgdddaeaianktenlelvalysfdfgltpsigynqskgknlgnygnkdlvkyiavgas
ydfnknmaavidykinllkdnqftddygintdnvlglgliyqf

SCOPe Domain Coordinates for d4d65c_:

Click to download the PDB-style file with coordinates for d4d65c_.
(The format of our PDB-style files is described here.)

Timeline for d4d65c_: