Lineage for d2n9ja_ (2n9j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691236Species Human (Homo sapiens) [TaxId:9606] [109644] (13 PDB entries)
    Uniprot P99999
  8. 2691270Domain d2n9ja_: 2n9j A: [311533]
    automated match to d3zcfa_
    complexed with hec

Details for d2n9ja_

PDB Entry: 2n9j (more details)

PDB Description: solution structure of oxidized human cytochrome c
PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2n9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9ja_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

SCOPe Domain Coordinates for d2n9ja_:

Click to download the PDB-style file with coordinates for d2n9ja_.
(The format of our PDB-style files is described here.)

Timeline for d2n9ja_: