SCOP 1.73: Domain d1akwa_: 1akw A:

Lineage for d1akwa_ (1akw A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)

8. Domain d1akwa_: 1akw A: [31153]
   complexed with fmn; mutant

Details for d1akwa_

PDB Entry: 1akw, 1.75 Å

PDB Description: g61l oxidized flavodoxin mutant

PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1akwa_:

Sequence; same for both SEQRES and ATOM records:

>d1akwa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwl
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

Timeline for d1akwa_:

• d1akwa_ first appeared (with stable ids) in SCOP 1.55, called d1akw__
  
• d1akwa_ was called d1akw__ in SCOP 1.71
  
• d1akwa_ appears in SCOP 1.75
  
• d1akwa_ appears in the current release, SCOPe 2.08