Lineage for d1akr__ (1akr -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21933Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 21934Family c.23.5.1: Flavodoxin-related [52219] (3 protein domains)
  6. 21935Protein Flavodoxin [52220] (6 species)
  7. 21975Species Desulfovibrio vulgaris [TaxId:881] [52222] (15 PDB entries)
  8. 21976Domain d1akr__: 1akr - [31152]

Details for d1akr__

PDB Entry: 1akr (more details), 1.58 Å

PDB Description: g61a oxidized flavodoxin mutant

SCOP Domain Sequences for d1akr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akr__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwa
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOP Domain Coordinates for d1akr__:

Click to download the PDB-style file with coordinates for d1akr__.
(The format of our PDB-style files is described here.)

Timeline for d1akr__: