![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
![]() | Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
![]() | Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
![]() | Protein Thaumatin [49876] (1 species) |
![]() | Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (117 PDB entries) Uniprot P02883 |
![]() | Domain d3x3oa_: 3x3o A: [311518] automated match to d1thva_ complexed with tla |
PDB Entry: 3x3o (more details), 1.48 Å
SCOPe Domain Sequences for d3x3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x3oa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]} atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda fsyvldkpttvtcpgssnyrvtfcpta
Timeline for d3x3oa_: