Lineage for d3x24b_ (3x24 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377796Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2377834Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2377844Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 2377845Species Rhodococcus erythropolis [TaxId:1833] [50103] (28 PDB entries)
    also Rhodococcus sp. R312
  8. 2377861Domain d3x24b_: 3x24 B: [311514]
    Other proteins in same PDB: d3x24a_
    automated match to d3wveb_
    complexed with fe, mg, tan; mutant

Details for d3x24b_

PDB Entry: 3x24 (more details), 1.24 Å

PDB Description: crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 120 min
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d3x24b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x24b_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevkyvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

SCOPe Domain Coordinates for d3x24b_:

Click to download the PDB-style file with coordinates for d3x24b_.
(The format of our PDB-style files is described here.)

Timeline for d3x24b_: