Lineage for d2mtba_ (2mtb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2856969Species Escherichia coli [TaxId:83333] [259351] (5 PDB entries)
  8. 2856974Domain d2mtba_: 2mtb A: [311512]
    automated match to d1yoba1

Details for d2mtba_

PDB Entry: 2mtb (more details)

PDB Description: solution structure of apo_fldb
PDB Compounds: (A:) Flavodoxin-2

SCOPe Domain Sequences for d2mtba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtba_ c.23.5.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
mnmglfygsstcytemaaekirdiigpelvtlhnlkddspklmeqydvlilgiptwdfge
iqedweavwdqlddlnlegkivalyglgdqlgygewfldalgmlhdklstkgvkfvgywp
tegyeftspkpviadgqlfvglaldetnqydlsderiqswceqilnemaehya

SCOPe Domain Coordinates for d2mtba_:

Click to download the PDB-style file with coordinates for d2mtba_.
(The format of our PDB-style files is described here.)

Timeline for d2mtba_: