SCOPe 2.08: Domain d2n0ma1: 2n0m A:3-130

Lineage for d2n0ma1 (2n0m A:3-130)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)

8. Domain d2n0ma1: 2n0m A:3-130 [311511]
   Other proteins in same PDB: d2n0ma2
   automated match to d3ay2a_
   complexed with cu1

Details for d2n0ma1

PDB Entry: 2n0m

PDB Description: the solution structure of the soluble form of the lipid-modified azurin from neisseria gonorrhoeae

PDB Compounds: (A:) Lipid modified azurin protein

SCOPe Domain Sequences for d2n0ma1:

Sequence; same for both SEQRES and ATOM records:

>d2n0ma1 b.6.1.0 (A:3-130) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
agncaatvesndnmqfntkdiqvskackeftitlkhtgtqpkasmghnlviakaedmdgv
fkdgvgaadtdyvkpddarvvahtkligggeessltldpakladgdykfactfpghgalm
ngkvtlvd

Timeline for d2n0ma1:

• d2n0ma1 first appeared in SCOPe 2.06
  
• d2n0ma1 appears in SCOPe 2.07