SCOP 1.61: Domain d2fcr__: 2fcr -

Lineage for d2fcr__ (2fcr -)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.5: Flavoproteins [52218] (3 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)

6. Protein Flavodoxin [52220] (7 species)

7. Species Chondrus crispus [TaxId:2769] [52221] (1 PDB entry)

8. Domain d2fcr__: 2fcr - [31151]

Details for d2fcr__

PDB Entry: 2fcr, 1.8 Å

PDB Description: crystal structure of oxidized flavodoxin from a red alga chondrus crispus refined at 1.8 angstroms resolution: description of the flavin mononucleotide binding site

SCOP Domain Sequences for d2fcr__:

Sequence; same for both SEQRES and ATOM records:

>d2fcr__ c.23.5.1 (-) Flavodoxin {Chondrus crispus}
kigiffststgnttevadfigktlgakadapidvddvtdpqalkdydllflgaptwntga
dtersgtswdeflydklpevdmkdlpvaifglgdaegypdnfcdaieeihdcfakqgakp
vgfsnpddydyeesksvrdgkflglpldmvndqipmekrvagwveavvsetgv

Timeline for d2fcr__:

• d2fcr__ first appeared (with stable ids) in SCOP 1.55
  
• d2fcr__ appears in SCOP 1.59
  
• d2fcr__ appears in SCOP 1.63
  
• d2fcr__ appears in the current release, SCOPe 2.08, called d2fcra_