Class g: Small proteins [56992] (100 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
Protein automated matches [190305] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311505] (1 PDB entry) |
Domain d2n52a_: 2n52 A: [311507] automated match to d2busa_ |
PDB Entry: 2n52 (more details)
SCOPe Domain Sequences for d2n52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n52a_ g.68.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qggqvdcgefqdtkvyctresnphcgsdgqtygnkcafckaivksggkislkhpgkc
Timeline for d2n52a_: