Lineage for d2n52a_ (2n52 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038536Protein automated matches [190305] (3 species)
    not a true protein
  7. 3038537Species Human (Homo sapiens) [TaxId:9606] [311505] (1 PDB entry)
  8. 3038538Domain d2n52a_: 2n52 A: [311507]
    automated match to d2busa_

Details for d2n52a_

PDB Entry: 2n52 (more details)

PDB Description: the solution structure of the kallikrein inhibitor spink6
PDB Compounds: (A:) Serine protease inhibitor Kazal-type 6

SCOPe Domain Sequences for d2n52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n52a_ g.68.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qggqvdcgefqdtkvyctresnphcgsdgqtygnkcafckaivksggkislkhpgkc

SCOPe Domain Coordinates for d2n52a_:

Click to download the PDB-style file with coordinates for d2n52a_.
(The format of our PDB-style files is described here.)

Timeline for d2n52a_: