SCOP 1.75: Domain d1eudb1: 1eud B:246-394

Lineage for d1eudb1 (1eud B:246-394)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries)

8. Domain d1eudb1: 1eud B:246-394 [31150]
   Other proteins in same PDB: d1euda1, d1euda2, d1eudb2
   complexed with so4; mutant

Details for d1eudb1

PDB Entry: 1eud, 2.1 Å

PDB Description: crystal structure of phosphorylated pig heart, gtp-specific succinyl- coa synthetase

PDB Compounds: (B:) succinyl-coa synthetase, beta chain

SCOP Domain Sequences for d1eudb1:

Sequence; same for both SEQRES and ATOM records:

>d1eudb1 c.23.4.1 (B:246-394) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvtk

Timeline for d1eudb1:

• d1eudb1 first appeared (with stable ids) in SCOP 1.55
  
• d1eudb1 appears in SCOP 1.73
  
• d1eudb1 appears in SCOPe 2.01
  
• d1eudb1 appears in the current release, SCOPe 2.08