Lineage for d1eudb1 (1eud B:246-394)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21905Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 21906Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 21920Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 21930Species Pig (Sus scrofa) [TaxId:9823] [52217] (2 PDB entries)
  8. 21932Domain d1eudb1: 1eud B:246-394 [31150]
    Other proteins in same PDB: d1euda1, d1euda2, d1eudb2

Details for d1eudb1

PDB Entry: 1eud (more details), 2.1 Å

PDB Description: crystal structure of phosphorylated pig heart, gtp-specific succinyl- coa synthetase

SCOP Domain Sequences for d1eudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eudb1 c.23.4.1 (B:246-394) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa)}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvtk

SCOP Domain Coordinates for d1eudb1:

Click to download the PDB-style file with coordinates for d1eudb1.
(The format of our PDB-style files is described here.)

Timeline for d1eudb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eudb2