Lineage for d1eudb1 (1eud B:246-394)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856295Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)
  7. 2856323Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries)
  8. 2856332Domain d1eudb1: 1eud B:246-394 [31150]
    Other proteins in same PDB: d1euda1, d1euda2, d1eudb2, d1eudb3
    complexed with so4

Details for d1eudb1

PDB Entry: 1eud (more details), 2.1 Å

PDB Description: crystal structure of phosphorylated pig heart, gtp-specific succinyl- coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase, beta chain

SCOPe Domain Sequences for d1eudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eudb1 c.23.4.1 (B:246-394) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvtk

SCOPe Domain Coordinates for d1eudb1:

Click to download the PDB-style file with coordinates for d1eudb1.
(The format of our PDB-style files is described here.)

Timeline for d1eudb1: