Lineage for d1eucb1 (1euc B:246-393)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481294Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 481295Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 481315Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 481329Species Pig (Sus scrofa) [TaxId:9823] [52217] (2 PDB entries)
  8. 481330Domain d1eucb1: 1euc B:246-393 [31149]
    Other proteins in same PDB: d1euca1, d1euca2, d1eucb2

Details for d1eucb1

PDB Entry: 1euc (more details), 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase

SCOP Domain Sequences for d1eucb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eucb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa)}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOP Domain Coordinates for d1eucb1:

Click to download the PDB-style file with coordinates for d1eucb1.
(The format of our PDB-style files is described here.)

Timeline for d1eucb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eucb2