SCOP 1.55: Domain d1eucb1: 1euc B:246-393

Lineage for d1eucb1 (1euc B:246-393)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (2 PDB entries)

8. Domain d1eucb1: 1euc B:246-393 [31149]
   Other proteins in same PDB: d1euca1, d1euca2, d1eucb2

Details for d1eucb1

PDB Entry: 1euc, 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase

SCOP Domain Sequences for d1eucb1:

Sequence; same for both SEQRES and ATOM records:

>d1eucb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa)}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

Timeline for d1eucb1:

• d1eucb1 appears in SCOP 1.57
  
• d1eucb1 appears in the current release, SCOPe 2.08