SCOPe 2.08: Domain d1eucb1: 1euc B:246-393

Lineage for d1eucb1 (1euc B:246-393)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (13 PDB entries)

8. Domain d1eucb1: 1euc B:246-393 [31149]
   Other proteins in same PDB: d1euca1, d1euca2, d1eucb2, d1eucb3
   complexed with po4, so4, zn

Details for d1eucb1

PDB Entry: 1euc, 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase

PDB Compounds: (B:) succinyl-coa synthetase, beta chain

SCOPe Domain Sequences for d1eucb1:

Sequence; same for both SEQRES and ATOM records:

>d1eucb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

Timeline for d1eucb1:

• d1eucb1 first appeared (with stable ids) in SCOP 1.55
  
• d1eucb1 appears in SCOPe 2.07