Lineage for d1scue1 (1scu E:239-388)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825828Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 825829Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 825871Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 825872Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 825896Domain d1scue1: 1scu E:239-388 [31146]
    Other proteins in same PDB: d1scua1, d1scua2, d1scub2, d1scud1, d1scud2, d1scue2
    complexed with coa, phs

Details for d1scue1

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution
PDB Compounds: (E:) succinyl-coa synthetase, beta subunit

SCOP Domain Sequences for d1scue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scue1 c.23.4.1 (E:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

SCOP Domain Coordinates for d1scue1:

Click to download the PDB-style file with coordinates for d1scue1.
(The format of our PDB-style files is described here.)

Timeline for d1scue1: