Lineage for d1cqje1 (1cqj E:239-385)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21905Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 21906Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 21920Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 21921Species Escherichia coli [TaxId:562] [52216] (4 PDB entries)
  8. 21925Domain d1cqje1: 1cqj E:239-385 [31144]
    Other proteins in same PDB: d1cqja1, d1cqja2, d1cqjb2, d1cqjd1, d1cqjd2, d1cqje2

Details for d1cqje1

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqje1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOP Domain Coordinates for d1cqje1:

Click to download the PDB-style file with coordinates for d1cqje1.
(The format of our PDB-style files is described here.)

Timeline for d1cqje1: