Lineage for d1cqjb1 (1cqj B:239-385)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) 
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species) 
Species Escherichia coli [TaxId:562] [52216] (11 PDB entries) 
Domain d1cqjb1: 1cqj B:239-385 [31143]
Other proteins in same PDB: d1cqja1, d1cqja2, d1cqjb2, d1cqjd1, d1cqjd2, d1cqje2
complexed with coa, po4
Details for d1cqjb1
PDB Entry: 1cqj (more details), 2.9 Å
PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase
PDB Compounds: (B:) succinyl-coa synthetase beta chainSCOPe Domain Sequences for d1cqjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqjb1 c.23.4.1 (B:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav
SCOPe Domain Coordinates for d1cqjb1:
Click to download the PDB-style file with coordinates for d1cqjb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cqjb1:
View in 3D
