Lineage for d2scue1 (2scu E:239-385)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356635Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1356636Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1356682Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 1356683Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
  8. 1356693Domain d2scue1: 2scu E:239-385 [31142]
    Other proteins in same PDB: d2scua1, d2scua2, d2scub2, d2scud1, d2scud2, d2scue2
    complexed with coa, so4

Details for d2scue1

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli
PDB Compounds: (E:) protein (succinyl-coa ligase)

SCOPe Domain Sequences for d2scue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scue1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOPe Domain Coordinates for d2scue1:

Click to download the PDB-style file with coordinates for d2scue1.
(The format of our PDB-style files is described here.)

Timeline for d2scue1: