SCOP 1.69: Domain d2scub1: 2scu B:239-385

Lineage for d2scub1 (2scu B:239-385)

Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (6 PDB entries)
Domain d2scub1: 2scu B:239-385 [31141]
Other proteins in same PDB: d2scua1, d2scua2, d2scub2, d2scud1, d2scud2, d2scue2

Details for d2scub1

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

SCOP Domain Sequences for d2scub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scub1 c.23.4.1 (B:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOP Domain Coordinates for d2scub1:

Click to download the PDB-style file with coordinates for d2scub1.
(The format of our PDB-style files is described here.)

Timeline for d2scub1: