Lineage for d1euca2 (1euc A:131-306)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578810Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 578811Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 578812Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 578826Species Pig (Sus scrofa) [TaxId:9823] [52214] (2 PDB entries)
  8. 578827Domain d1euca2: 1euc A:131-306 [31139]
    Other proteins in same PDB: d1euca1, d1eucb1, d1eucb2
    complexed with po4, so4, zn; mutant

Details for d1euca2

PDB Entry: 1euc (more details), 2.1 Å

PDB Description: crystal structure of dephosphorylated pig heart, gtp-specific succinyl-coa synthetase

SCOP Domain Sequences for d1euca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euca2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa)}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOP Domain Coordinates for d1euca2:

Click to download the PDB-style file with coordinates for d1euca2.
(The format of our PDB-style files is described here.)

Timeline for d1euca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1euca1