![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
![]() | Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) ![]() |
![]() | Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins) |
![]() | Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [52214] (2 PDB entries) |
![]() | Domain d1euca2: 1euc A:131-306 [31139] Other proteins in same PDB: d1euca1, d1eucb1, d1eucb2 |
PDB Entry: 1euc (more details), 2.1 Å
SCOP Domain Sequences for d1euca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1euca2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa)} ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml
Timeline for d1euca2: