SCOP 1.55: Domain d1scua2: 1scu A:122-288

Lineage for d1scua2 (1scu A:122-288)

Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species)
Species Escherichia coli [TaxId:562] [52213] (4 PDB entries)
Domain d1scua2: 1scu A:122-288 [31135]
Other proteins in same PDB: d1scua1, d1scub1, d1scub2, d1scud1, d1scue1, d1scue2

Details for d1scua2

PDB Entry: 1scu (more details), 2.5 Å

PDB Description: the crystal structure of succinyl-coa synthetase from escherichia coli at 2.5 angstroms resolution

SCOP Domain Sequences for d1scua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scua2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvlk

SCOP Domain Coordinates for d1scua2:

Click to download the PDB-style file with coordinates for d1scua2.
(The format of our PDB-style files is described here.)

Timeline for d1scua2: