Lineage for d1cqjd2 (1cqj D:122-286)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21905Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 21906Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 21907Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species)
  7. 21908Species Escherichia coli [TaxId:562] [52213] (4 PDB entries)
  8. 21912Domain d1cqjd2: 1cqj D:122-286 [31134]
    Other proteins in same PDB: d1cqja1, d1cqjb1, d1cqjb2, d1cqjd1, d1cqje1, d1cqje2

Details for d1cqjd2

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqjd2 c.23.4.1 (D:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOP Domain Coordinates for d1cqjd2:

Click to download the PDB-style file with coordinates for d1cqjd2.
(The format of our PDB-style files is described here.)

Timeline for d1cqjd2: