SCOPe 2.06: Domain d1cqja2: 1cqj A:122-286

Lineage for d1cqja2 (1cqj A:122-286)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
Domain d1cqja2: 1cqj A:122-286 [31133]
Other proteins in same PDB: d1cqja1, d1cqjb1, d1cqjb2, d1cqjd1, d1cqje1, d1cqje2
complexed with coa, po4

Details for d1cqja2

PDB Entry: 1cqj (more details), 2.9 Å

PDB Description: crystal structure of dephosphorylated e. coli succinyl-coa synthetase

PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOPe Domain Sequences for d1cqja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqja2 c.23.4.1 (A:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOPe Domain Coordinates for d1cqja2:

Click to download the PDB-style file with coordinates for d1cqja2.
(The format of our PDB-style files is described here.)

Timeline for d1cqja2: