| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) ![]() |
| Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
| Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species) |
| Species Escherichia coli [TaxId:562] [52213] (11 PDB entries) |
| Domain d1cqja2: 1cqj A:122-286 [31133] Other proteins in same PDB: d1cqja1, d1cqjb1, d1cqjb2, d1cqjd1, d1cqje1, d1cqje2 complexed with coa, po4 |
PDB Entry: 1cqj (more details), 2.9 Å
SCOPe Domain Sequences for d1cqja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqja2 c.23.4.1 (A:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv
Timeline for d1cqja2: