SCOP 1.59: Domain d2scud2: 2scu D:122-286

Lineage for d2scud2 (2scu D:122-286)

Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species)
Species Escherichia coli [TaxId:562] [52213] (6 PDB entries)
Domain d2scud2: 2scu D:122-286 [31132]
Other proteins in same PDB: d2scua1, d2scub1, d2scub2, d2scud1, d2scue1, d2scue2

Details for d2scud2

PDB Entry: 2scu (more details), 2.3 Å

PDB Description: A detailed description of the structure of Succinyl-COA synthetase from Escherichia coli

SCOP Domain Sequences for d2scud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scud2 c.23.4.1 (D:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOP Domain Coordinates for d2scud2:

Click to download the PDB-style file with coordinates for d2scud2.
(The format of our PDB-style files is described here.)

Timeline for d2scud2: