Lineage for d1fywa_ (1fyw A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21891Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (1 family) (S)
  5. 21892Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (2 proteins)
  6. 21896Protein Toll-like receptor 2, TLR2 [52204] (1 species)
  7. 21897Species Human (Homo sapiens) [TaxId:9606] [52205] (2 PDB entries)
  8. 21899Domain d1fywa_: 1fyw A: [31129]

Details for d1fywa_

PDB Entry: 1fyw (more details), 3 Å

PDB Description: crystal structure of the tir domain of human tlr2

SCOP Domain Sequences for d1fywa_:

Sequence, based on SEQRES records: (download)

>d1fywa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens)}
srnixydafvsyserdaywvenlmvqelenfnppfklxlhkrdfipgkwiidniidsiek
shktvfvlsenfvksewxkyeldfshfrlfdenndaailillepiekkaipqrfxklrki
mntktylewpmdeaqregfwvnlraaiks

Sequence, based on observed residues (ATOM records): (download)

>d1fywa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens)}
srniydafvsyserdaywvenlmvqelenfnppfkllhkrdfipgkwiidniidsieksh
ktvfvlsenfvksewkyeldfshfrlfdenndaailillepiekkaipqrfklrkimntk
tylewpmdeaqregfwvnlraaiks

SCOP Domain Coordinates for d1fywa_:

Click to download the PDB-style file with coordinates for d1fywa_.
(The format of our PDB-style files is described here.)

Timeline for d1fywa_: