Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.3: Positive regulator of the amidase operon AmiR [52197] (1 protein) |
Protein Positive regulator of the amidase operon AmiR [52198] (1 species) contains coiled coil and small all-alpha subdomains in the C-terminal extension |
Species Pseudomonas aeruginosa [TaxId:287] [52199] (1 PDB entry) |
Domain d1qo0e_: 1qo0 E: [31126] Other proteins in same PDB: d1qo0a_, d1qo0b_ complexed with bmd |
PDB Entry: 1qo0 (more details), 2.25 Å
SCOPe Domain Sequences for d1qo0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qo0e_ c.23.1.3 (E:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep ilkiaqellgneps
Timeline for d1qo0e_: