Lineage for d1qo0e_ (1qo0 E:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68134Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 68251Family c.23.1.3: Negative regulator of the amidase operon AmiR [52197] (1 protein)
  6. 68252Protein Negative regulator of the amidase operon AmiR [52198] (1 species)
  7. 68253Species Pseudomonas aeruginosa [TaxId:287] [52199] (1 PDB entry)
  8. 68255Domain d1qo0e_: 1qo0 E: [31126]
    Other proteins in same PDB: d1qo0a_, d1qo0b_

Details for d1qo0e_

PDB Entry: 1qo0 (more details), 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

SCOP Domain Sequences for d1qo0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo0e_ c.23.1.3 (E:) Negative regulator of the amidase operon AmiR {Pseudomonas aeruginosa}
sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif
qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs
arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep
ilkiaqellgneps

SCOP Domain Coordinates for d1qo0e_:

Click to download the PDB-style file with coordinates for d1qo0e_.
(The format of our PDB-style files is described here.)

Timeline for d1qo0e_: