SCOP 1.59: Domain d1qo0d_: 1qo0 D:

Lineage for d1qo0d_ (1qo0 D:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.1: CheY-like [52172] (3 families)

5. Family c.23.1.3: Negative regulator of the amidase operon AmiR [52197] (1 protein)

6. Protein Negative regulator of the amidase operon AmiR [52198] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [52199] (1 PDB entry)

8. Domain d1qo0d_: 1qo0 D: [31125]
   Other proteins in same PDB: d1qo0a_, d1qo0b_

Details for d1qo0d_

PDB Entry: 1qo0, 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.

SCOP Domain Sequences for d1qo0d_:

Sequence; same for both SEQRES and ATOM records:

>d1qo0d_ c.23.1.3 (D:) Negative regulator of the amidase operon AmiR {Pseudomonas aeruginosa}
sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif
qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs
arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep
ilkiaqell

Timeline for d1qo0d_:

• d1qo0d_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo0d_ appears in SCOP 1.57
  
• d1qo0d_ appears in SCOP 1.61
  
• d1qo0d_ appears in the current release, SCOPe 2.08