SCOP 1.59: Domain d1b00b_: 1b00 B:

Lineage for d1b00b_ (1b00 B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.1: CheY-like [52172] (3 families)

5. Family c.23.1.1: CheY-related [52173] (9 proteins)

6. Protein PhoB receiver domain [52192] (2 species)

7. Species Escherichia coli [TaxId:562] [52193] (1 PDB entry)

8. Domain d1b00b_: 1b00 B: [31123]

Details for d1b00b_

PDB Entry: 1b00, 1.88 Å

PDB Description: phob receiver domain from escherichia coli

SCOP Domain Sequences for d1b00b_:

Sequence; same for both SEQRES and ATOM records:

>d1b00b_ c.23.1.1 (B:) PhoB receiver domain {Escherichia coli}
arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg
iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
ri

Timeline for d1b00b_:

• d1b00b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b00b_ appears in SCOP 1.57
  
• d1b00b_ appears in SCOP 1.61
  
• d1b00b_ appears in the current release, SCOPe 2.08