![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein PhoB receiver domain [52192] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52193] (1 PDB entry) |
![]() | Domain d1b00a_: 1b00 A: [31122] |
PDB Entry: 1b00 (more details), 1.88 Å
SCOPe Domain Sequences for d1b00a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b00a_ c.23.1.1 (A:) PhoB receiver domain {Escherichia coli [TaxId: 562]} arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr ri
Timeline for d1b00a_: