Lineage for d1b00a_ (1b00 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 21845Protein PhoB receiver domain [52192] (1 species)
  7. 21846Species Escherichia coli [TaxId:562] [52193] (1 PDB entry)
  8. 21847Domain d1b00a_: 1b00 A: [31122]

Details for d1b00a_

PDB Entry: 1b00 (more details), 1.88 Å

PDB Description: phob receiver domain from escherichia coli

SCOP Domain Sequences for d1b00a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b00a_ c.23.1.1 (A:) PhoB receiver domain {Escherichia coli}
arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg
iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
ri

SCOP Domain Coordinates for d1b00a_:

Click to download the PDB-style file with coordinates for d1b00a_.
(The format of our PDB-style files is described here.)

Timeline for d1b00a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b00b_