Lineage for d1a2oa1 (1a2o A:1-140)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837837Protein Methylesterase CheB, N-terminal domain [52190] (1 species)
  7. 1837838Species Salmonella typhimurium [TaxId:90371] [52191] (1 PDB entry)
  8. 1837839Domain d1a2oa1: 1a2o A:1-140 [31120]
    Other proteins in same PDB: d1a2oa2, d1a2ob2

Details for d1a2oa1

PDB Entry: 1a2o (more details), 2.4 Å

PDB Description: structural basis for methylesterase cheb regulation by a phosphorylation-activated domain
PDB Compounds: (A:) cheb methylesterase

SCOPe Domain Sequences for d1a2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
emiaekvrtaarariaahkp

SCOPe Domain Coordinates for d1a2oa1:

Click to download the PDB-style file with coordinates for d1a2oa1.
(The format of our PDB-style files is described here.)

Timeline for d1a2oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a2oa2