![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
![]() | Superfamily c.23.1: CheY-like [52172] (3 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (9 proteins) |
![]() | Protein Methylesterase CheB, N-terminal domain [52190] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [52191] (1 PDB entry) |
![]() | Domain d1a2oa1: 1a2o A:1-140 [31120] Other proteins in same PDB: d1a2oa2, d1a2ob2 |
PDB Entry: 1a2o (more details), 2.4 Å
SCOP Domain Sequences for d1a2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium} mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays emiaekvrtaarariaahkp
Timeline for d1a2oa1: