Lineage for d1a2oa1 (1a2o A:1-140)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68134Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 68135Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 68196Protein Methylesterase CheB, N-terminal domain [52190] (1 species)
  7. 68197Species Salmonella typhimurium [TaxId:90371] [52191] (1 PDB entry)
  8. 68198Domain d1a2oa1: 1a2o A:1-140 [31120]
    Other proteins in same PDB: d1a2oa2, d1a2ob2

Details for d1a2oa1

PDB Entry: 1a2o (more details), 2.4 Å

PDB Description: structural basis for methylesterase cheb regulation by a phosphorylation-activated domain

SCOP Domain Sequences for d1a2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium}
mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
emiaekvrtaarariaahkp

SCOP Domain Coordinates for d1a2oa1:

Click to download the PDB-style file with coordinates for d1a2oa1.
(The format of our PDB-style files is described here.)

Timeline for d1a2oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a2oa2