Lineage for d1a2oa1 (1a2o A:1-140)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21774Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 21775Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 21831Protein Methylesterase CheB, N-terminal domain [52190] (1 species)
  7. 21832Species Salmonella typhimurium [TaxId:90371] [52191] (1 PDB entry)
  8. 21833Domain d1a2oa1: 1a2o A:1-140 [31120]
    Other proteins in same PDB: d1a2oa2, d1a2ob2

Details for d1a2oa1

PDB Entry: 1a2o (more details), 2.4 Å

PDB Description: structural basis for methylesterase cheb regulation by a phosphorylation-activated domain

SCOP Domain Sequences for d1a2oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium}
mskirvlsvddsalmrqimteiinshsdmemvatapdplvardlikkfnpdvltldvemp
rmdgldfleklmrlrpmpvvmvssltgkgsevtlralelgaidfvtkpqlgiregmlays
emiaekvrtaarariaahkp

SCOP Domain Coordinates for d1a2oa1:

Click to download the PDB-style file with coordinates for d1a2oa1.
(The format of our PDB-style files is described here.)

Timeline for d1a2oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a2oa2