Lineage for d1fspa_ (1fsp A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114938Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 2114939Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
    Uniprot P06628
  8. 2114958Domain d1fspa_: 1fsp A: [31118]

Details for d1fspa_

PDB Entry: 1fsp (more details)

PDB Description: nmr solution structure of bacillus subtilis spo0f protein, 20 structures
PDB Compounds: (A:) stage 0 sporulation protein f

SCOPe Domain Sequences for d1fspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fspa_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn

SCOPe Domain Coordinates for d1fspa_:

Click to download the PDB-style file with coordinates for d1fspa_.
(The format of our PDB-style files is described here.)

Timeline for d1fspa_: