Lineage for d1fspa_ (1fsp A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825716Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 825717Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries)
    Uniprot P06628
  8. 825730Domain d1fspa_: 1fsp A: [31118]

Details for d1fspa_

PDB Entry: 1fsp (more details)

PDB Description: nmr solution structure of bacillus subtilis spo0f protein, 20 structures
PDB Compounds: (A:) stage 0 sporulation protein f

SCOP Domain Sequences for d1fspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fspa_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn

SCOP Domain Coordinates for d1fspa_:

Click to download the PDB-style file with coordinates for d1fspa_.
(The format of our PDB-style files is described here.)

Timeline for d1fspa_: