Lineage for d1f51g_ (1f51 G:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578576Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 578577Family c.23.1.1: CheY-related [52173] (18 proteins)
  6. 578732Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 578733Species Bacillus subtilis [TaxId:1423] [52189] (7 PDB entries)
  8. 578740Domain d1f51g_: 1f51 G: [31116]
    Other proteins in same PDB: d1f51a_, d1f51b_, d1f51c_, d1f51d_

Details for d1f51g_

PDB Entry: 1f51 (more details), 3 Å

PDB Description: a transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction

SCOP Domain Sequences for d1f51g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f51g_ c.23.1.1 (G:) Sporulation response regulator Spo0F {Bacillus subtilis}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOP Domain Coordinates for d1f51g_:

Click to download the PDB-style file with coordinates for d1f51g_.
(The format of our PDB-style files is described here.)

Timeline for d1f51g_: