Lineage for d1f51f_ (1f51 F:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691775Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 691776Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries)
  8. 691786Domain d1f51f_: 1f51 F: [31115]
    Other proteins in same PDB: d1f51a_, d1f51b_, d1f51c_, d1f51d_

Details for d1f51f_

PDB Entry: 1f51 (more details), 3 Å

PDB Description: a transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
PDB Compounds: (F:) sporulation initiation phosphotransferase f

SCOP Domain Sequences for d1f51f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f51f_ c.23.1.1 (F:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOP Domain Coordinates for d1f51f_:

Click to download the PDB-style file with coordinates for d1f51f_.
(The format of our PDB-style files is described here.)

Timeline for d1f51f_: