SCOP 1.73: Domain d1srra_: 1srr A:

Lineage for d1srra_ (1srr A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Sporulation response regulator Spo0F [52188] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries)

8. Domain d1srra_: 1srr A: [31110]

Details for d1srra_

PDB Entry: 1srr, 1.9 Å

PDB Description: crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis

PDB Compounds: (A:) sporulation response regulatory protein

SCOP Domain Sequences for d1srra_:

Sequence; same for both SEQRES and ATOM records:

>d1srra_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

Timeline for d1srra_:

• d1srra_ first appeared (with stable ids) in SCOP 1.55
  
• d1srra_ appears in SCOP 1.71
  
• d1srra_ appears in SCOP 1.75
  
• d1srra_ appears in the current release, SCOPe 2.08