Lineage for d1qmpd_ (1qmp D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101816Protein Sporulation response regulator Spo0A [52186] (1 species)
  7. 2101817Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries)
  8. 2101822Domain d1qmpd_: 1qmp D: [31109]
    complexed with ca

Details for d1qmpd_

PDB Entry: 1qmp (more details), 2 Å

PDB Description: phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a
PDB Compounds: (D:) spo0a

SCOPe Domain Sequences for d1qmpd_:

Sequence, based on SEQRES records: (download)

>d1qmpd_ c.23.1.1 (D:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gkttpvv

Sequence, based on observed residues (ATOM records): (download)

>d1qmpd_ c.23.1.1 (D:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriraghqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvygk
ttpvv

SCOPe Domain Coordinates for d1qmpd_:

Click to download the PDB-style file with coordinates for d1qmpd_.
(The format of our PDB-style files is described here.)

Timeline for d1qmpd_: