Lineage for d1qmpb_ (1qmp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101816Protein Sporulation response regulator Spo0A [52186] (1 species)
  7. 2101817Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries)
  8. 2101820Domain d1qmpb_: 1qmp B: [31107]
    complexed with ca

Details for d1qmpb_

PDB Entry: 1qmp (more details), 2 Å

PDB Description: phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a
PDB Compounds: (B:) spo0a

SCOPe Domain Sequences for d1qmpb_:

Sequence, based on SEQRES records: (download)

>d1qmpb_ c.23.1.1 (B:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gkttpvv

Sequence, based on observed residues (ATOM records): (download)

>d1qmpb_ c.23.1.1 (B:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriraqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvygtpv
v

SCOPe Domain Coordinates for d1qmpb_:

Click to download the PDB-style file with coordinates for d1qmpb_.
(The format of our PDB-style files is described here.)

Timeline for d1qmpb_: