SCOPe 2.06: Domain d1qmpa_: 1qmp A:

Lineage for d1qmpa_ (1qmp A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Sporulation response regulator Spo0A [52186] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries)

8. Domain d1qmpa_: 1qmp A: [31106]
   complexed with ca

Details for d1qmpa_

PDB Entry: 1qmp, 2 Å

PDB Description: phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a

PDB Compounds: (A:) spo0a

SCOPe Domain Sequences for d1qmpa_:

Sequence, based on SEQRES records:

>d1qmpa_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gkttpvv

Sequence, based on observed residues (ATOM records):

>d1qmpa_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gktpvv

Timeline for d1qmpa_:

• d1qmpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qmpa_ appears in SCOPe 2.05
  
• d1qmpa_ appears in SCOPe 2.07
  
• d1qmpa_ appears in the current release, SCOPe 2.08