SCOPe 2.05: Domain d1dz3a_: 1dz3 A:

Lineage for d1dz3a_ (1dz3 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Sporulation response regulator Spo0A [52186] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [52187] (2 PDB entries)

8. Domain d1dz3a_: 1dz3 A: [31105]
   C-terminal helix-swapping dimer
   complexed with so4

Details for d1dz3a_

PDB Entry: 1dz3, 1.65 Å

PDB Description: domain-swapping in the sporulation response regulator spo0a

PDB Compounds: (A:) stage 0 sporulation protein a

SCOPe Domain Sequences for d1dz3a_:

Sequence; same for both SEQRES and ATOM records:

>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
sikvciaddnrelvslldeyissqpdmevigtayngqdclqmleekrpdillldiimphl
dglavleriragfehqpnvimltafgqedvtkkavelgasyfilkpfdmenlahhirqvy
gkt

Timeline for d1dz3a_:

• d1dz3a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dz3a_ appears in SCOPe 2.04
  
• d1dz3a_ appears in SCOPe 2.06
  
• d1dz3a_ appears in the current release, SCOPe 2.08