| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein Transcriptional regulatory protein DctD, receiver domain [52184] (1 species) |
| Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [52185] (3 PDB entries) |
| Domain d1qkka1: 1qkk A:5-143 [31104] Other proteins in same PDB: d1qkka2 also includes a part of the linker region |
PDB Entry: 1qkk (more details), 1.7 Å
SCOPe Domain Sequences for d1qkka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkka1 c.23.1.1 (A:5-143) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
psvflidddrdlrkamqqtlelagftvssfasatealaglsadfagivisdirmpgmdgl
alfrkilaldpdlpmilvtghgdipmavqaiqdgaydfiakpfaadrlvqsarraeekrr
lvmenrslrraaeaasegl
Timeline for d1qkka1: