SCOPe 2.07: Domain d1dcmb_: 1dcm B:

Lineage for d1dcmb_ (1dcm B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)

7. Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)

8. Domain d1dcmb_: 1dcm B: [31103]
   complexed with mg

Details for d1dcmb_

PDB Entry: 1dcm, 3 Å

PDB Description: structure of unphosphorylated fixj-n with an atypical conformer (monomer a)

PDB Compounds: (B:) transcriptional regulatory protein fixj

SCOPe Domain Sequences for d1dcmb_:

Sequence; same for both SEQRES and ATOM records:

>d1dcmb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
dytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdmsg
vellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierasehl
v

Timeline for d1dcmb_:

• d1dcmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dcmb_ appears in SCOPe 2.06
  
• d1dcmb_ appears in the current release, SCOPe 2.08