SCOP 1.59: Domain d1dcmb_: 1dcm B:

Lineage for d1dcmb_ (1dcm B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.1: CheY-like [52172] (3 families)

5. Family c.23.1.1: CheY-related [52173] (9 proteins)

6. Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)

7. Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)

8. Domain d1dcmb_: 1dcm B: [31103]

Details for d1dcmb_

PDB Entry: 1dcm, 3 Å

PDB Description: structure of unphosphorylated fixj-n with an atypical conformer (monomer a)

SCOP Domain Sequences for d1dcmb_:

Sequence; same for both SEQRES and ATOM records:

>d1dcmb_ c.23.1.1 (B:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti}
dytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdmsg
vellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierasehl
v

Timeline for d1dcmb_:

• d1dcmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dcmb_ appears in SCOP 1.57
  
• d1dcmb_ appears in SCOP 1.61
  
• d1dcmb_ appears in the current release, SCOPe 2.08